ERK1 anticorps (AA 372-406)

N° du produit ABIN199418

L’anticorps Lapin Polyclonal anti-ERK1 a été validé pour WB, IP et Func. Il convient pour détecter ERK1 dans des échantillons de Souris, Rat, Lapin et Hamster.

Aperçu rapide pour ERK1 anticorps (AA 372-406) (ABIN199418)

Antigène: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Reactivité: Souris, Rat, Lapin, Hamster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERK1 est non-conjugé

Application: Western Blotting (WB), Immunoprecipitation (IP), Functional Studies (Func)

Détail du produit anti-ERK1 anticorps

Épitope: AA 372-406

Specificité: Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.

Homologie: Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).

Purification: Immunoaffinity purified

Immunogène: Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated

Isotype: IgG

Information d'application

Indications d'application: Approved: Func, IP, WB (0.1 - 2 μg/mL)

Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.

Commentaires:

Target Species of Antibody: Rat

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: 0.2 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeat freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Détails sur ERK1

Antigène: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Autre désignation: MAPK3 / ERK1

Sujet: Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3

ID gène: 5595

UniProt: P27361

Pathways: Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins